PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C018430P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 383aa    MW: 42489.7 Da    PI: 7.7246
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C018430P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.2e-31236291156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF +a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  MELO3C018430P2 236 KQRRCWSPELHRRFENALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 291
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.435233293IPR017930Myb domain
SuperFamilySSF466895.89E-18234294IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-28235294IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-26236291IPR006447Myb domain, plants
PfamPF002491.3E-7238289IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MPSLSPPNTI SHFLHQISSL SNPSDRASTL HSLITNLEDE MKKIDAFKRE LPLCMLLLND  60
AILALKDTSL QCASSCSSPK RKPVLEEFMS LNKDSSDENE KEEDCRDKKE WMSSVQLWKT  120
DDLQNTQIKT KRNEGWGYVA AAEDRIHRKK NEEGLFVGFK PSSSAFPALA AVKKEEKIES  180
PICALSLVTP NLKTTREESV SCVLRSSGNR ATSTSAADIQ SNLRTALPPQ QQPARKQRRC  240
WSPELHRRFE NALQQLGGSQ VATPKQIREL MQVDGLTNDE VKSHLQKYRL HTRRLPTTPA  300
ARAADQSPVV LGDLWMSQDG CGESSKVSSS QSASPQGPLQ FAGNGGYSTT GGYSMEDDED  360
TKSESYDYWK SQAHTGKRCI NI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008454913.10.0PREDICTED: putative two-component response regulator ARR13
TrEMBLA0A0A0K4U60.0A0A0A0K4U6_CUCSA; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.11e-44G2-like family protein